PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN12131.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 315aa    MW: 33337.9 Da    PI: 8.8193
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN12131.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.95.3e-3973130461
      zf-Dof   4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                 ++l+cprCds+ntkfCyynny+l+qPr+fCk+CrryWtkGGalrnvP+Ggg+rk+k+s
  KHN12131.1  73 ENLRCPRCDSSNTKFCYYNNYNLTQPRHFCKTCRRYWTKGGALRNVPIGGGCRKSKSS 130
                 6789***************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027015.6E-3374129IPR003851Zinc finger, Dof-type
ProDomPD0074782.0E-2575126IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.43275129IPR003851Zinc finger, Dof-type
PROSITE patternPS01361077113IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MIQELLGGAL IAGERKPSSI NGGGGGGGVL LPITTPSPSS FPSSTTSDVT LTSTTTTAAT  60
TAATAATTTT AVENLRCPRC DSSNTKFCYY NNYNLTQPRH FCKTCRRYWT KGGALRNVPI  120
GGGCRKSKSS GMSNSVAKQT ATKMKAVASE LGRATQTQNP NPNPSPMSLK EEGTLLGHMV  180
STDQPLVSNT LLSYRTLGYD AVAQVPSSLG LFGRNNQDQQ QQNGGFLVGE HHNNSGIQEL  240
YQKLRSSSTV NNNYCSDNNS SQMFMGNMAS NYSSSVSNNI LETTSVAGGE FGYWNGPTFS  300
NWSDLPTTNG AGAYP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ8572650.0DQ857265.1 Glycine max Dof15 mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003550086.11e-164PREDICTED: dof zinc finger protein DOF5.7
TrEMBLA0A0B2PRW40.0A0A0B2PRW4_GLYSO; Dof zinc finger protein DOF5.7
STRINGGLYMA17G21540.11e-164(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF72193247
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.11e-33DOF zinc finger protein 1
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]